2.50 Rating by CuteStat

This website is a sub-domain of ihfa.org. It has a global traffic rank of #3830126 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, lender.ihfa.org is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 220
Daily Pageviews: 440

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 144
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 4,320
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 3,830,126
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.20.47.249

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 3
H3 Headings: 3 H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 4
Google Adsense: Not Applicable Google Analytics: UA-82226761-1

Websites Hosted on Same IP (i.e. 104.20.47.249)

Omniplex Cinemas - Book film tickets & get movie times

- omniplex.ie

Find the latest movie times in 2D, 3D, MAXX and Recline Omniplex Cinema. Browse movie times, watch movie trailers, find cinema deals, and book your cinema tickets online today.

107,316 $ 111,600.00

Omniplex Cinemas - Book film tickets & get movie times

- iphone.omniplex.ie

Find the latest movie times in 2D, 3D, MAXX and Recline Omniplex Cinema. Browse movie times, watch movie trailers, find cinema deals, and book your cinema tickets online today.

107,316 $ 111,600.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 09 Jan 2020 12:41:42 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: private
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 55267ca86ba4eb29-LAX
Content-Encoding: gzip

DNS Record Analysis

Host Type TTL Extra
lender.ihfa.org A 299 IP: 104.20.47.249
lender.ihfa.org A 299 IP: 104.20.46.249
lender.ihfa.org AAAA 300 IPV6: 2606:4700:10::6814:2ff9
lender.ihfa.org AAAA 300 IPV6: 2606:4700:10::6814:2ef9

Similarly Ranked Websites

The Athletics Federation of Nigeria | AFN

- athleticsnigeria.org

The Athletics Federation of Nigeria (AFN) is the governing body for the sport of track and field Athletics in Nigeria, West Africa.

3,830,128 $ 240.00

WordPress-Gear

- wpgear.org
3,830,135 $ 240.00

404 Not Found

- watchintenselyspeedythefile.vip
3,830,141 $ 240.00

Busty Galleries : 1000`s of Free Big tits, BBW, Mature, Ebony, Fat and

- bustygalleries.com

Busty Galleries Is Free Movie Site with fresh big tits, bbw, fat, mature, ebony and pregnant movie XXX galleries, daily updated

3,830,143 $ 240.00

The Tile & Stone Specialist | Lapicida

- lapicida.com

Lapicida is the leading specialist in luxury surfaces, supplying new and antique natural stone alongside ceramics, porcelains, quartz and manmade ‘sintered’ stone. Based in Yorkshire, we work with architects, interior designers, retailers and trade customers across the UK, Europe and the US.

3,830,146 $ 240.00